Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0789400_circ_g.2 |
| ID in PlantcircBase | osa_circ_016866 |
| Alias | Os_ciR8163 |
| Organism | Oryza sativa |
| Position | chr2: 33544793-33545464 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0789400 |
| Parent gene annotation |
Similar to 9G8-like SR protein (RSZp22 splicing factor). (Os02t0 789400-01);Similar to 9G8-like SR protein (RSZp22 splicing facto r). (Os02t0789400-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0789400_circ_g.1 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0789400-01:2 Os02t0789400-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.250653336 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33545453-33545414(-) 33544797-33545398(-) |
| Potential amino acid sequence |
MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGICSR WPACMLATWIPE*(-) MGFVHDGPLVCWQLGSPSDFRGT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |