Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0789400_circ_g.2 |
ID in PlantcircBase | osa_circ_016866 |
Alias | Os_ciR8163 |
Organism | Oryza sativa |
Position | chr2: 33544793-33545464 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0789400 |
Parent gene annotation |
Similar to 9G8-like SR protein (RSZp22 splicing factor). (Os02t0 789400-01);Similar to 9G8-like SR protein (RSZp22 splicing facto r). (Os02t0789400-02) |
Parent gene strand | - |
Alternative splicing | Os02g0789400_circ_g.1 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0789400-01:2 Os02t0789400-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.250653336 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
33545453-33545414(-) 33544797-33545398(-) |
Potential amino acid sequence |
MARLYVGNLDPRVTSGELEDEFRVFGVLRSVWVARKPPGFAFIDFDDKRDAEDALRDLDGICSR WPACMLATWIPE*(-) MGFVHDGPLVCWQLGSPSDFRGT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |