Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G35530_circ_g.2 |
ID in PlantcircBase | ath_circ_041089 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 13710656-13710787 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G35530 |
Parent gene annotation |
40S ribosomal protein S3-3 |
Parent gene strand | - |
Alternative splicing | AT5G35530_circ_g.3 AT5G35530_circ_g.4 AT5G35530_circ_g.5 AT5G35530_circ_g.6 AT5G35530_circ_g.7 AT5G35530_circ_g.8 |
Support reads | 35 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G35530.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.432782891 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13710746-13710658(-) |
Potential amino acid sequence |
MKFKDGYMVSSGQPTKEYIDAAVRHVLLRQVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYID AAVRHVLLRQVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYIDAAVRHVLLRQVIVSGKLRAA RAKSMKFKDGYMVSSGQPTKEYIDAAVRHVLLRQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |