Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0682800_circ_g.1 |
| ID in PlantcircBase | osa_circ_025990 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34861192-34862355 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os04g0682800 |
| Parent gene annotation |
Potassium efflux antiporter, Chloroplast development, Drought to lerance (Os04t0682800-01);Similar to H0124B04.17 protein. (Os04t 0682800-02);Non-protein coding transcript. (Os04t0682800-03);Sim ilar to H0124B04.17 protein. (Os04t0682800-04) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0682800-04:2 Os04t0682800-02:4 Os04t0682800-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160740743 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34862087-34862355(-) |
| Potential amino acid sequence |
MMWIMVLTWRKLVQQRLSLRPWNQVSSWLLLFLHRQNSQCQRLQQLSMSSGTVICQSSQSDRVA VGRALDLPVYFGDAGSREVLHKVGAERACAAAITLDTPGANYRAVWALSKYFPNVKTFVRAHDV DHGVNLEKAGATAVVPETLEPSLQLAAAVLAQAKLPMSEIAATVNEFRNRHLSELTE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |