Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0360600_circ_g.2 |
ID in PlantcircBase | osa_circ_030799 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 14911976-14912714 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0360600 |
Parent gene annotation |
Similar to OSIGBa0104J13.3 protein. (Os06t0360600-01);Conserved hypothetical protein. (Os06t0360600-02);Hypothetical conserved g ene. (Os06t0360600-03) |
Parent gene strand | - |
Alternative splicing | Os06g0360600_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0360600-03:3 Os06t0360600-01:3 Os06t0360600-02:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.211136491 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14912156-14912153(-) |
Potential amino acid sequence |
MKGSRLPAAWQLLFRISLPINCYCLAWSYFWKHKRKDHIYYPIITLTTLDHTFGGCCMQLLLSK P*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |