Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0360600_circ_g.2 |
| ID in PlantcircBase | osa_circ_030799 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 14911976-14912714 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0360600 |
| Parent gene annotation |
Similar to OSIGBa0104J13.3 protein. (Os06t0360600-01);Conserved hypothetical protein. (Os06t0360600-02);Hypothetical conserved g ene. (Os06t0360600-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0360600_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0360600-03:3 Os06t0360600-01:3 Os06t0360600-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.211136491 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14912156-14912153(-) |
| Potential amino acid sequence |
MKGSRLPAAWQLLFRISLPINCYCLAWSYFWKHKRKDHIYYPIITLTTLDHTFGGCCMQLLLSK P*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |