Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G05960_circ_g.1 |
ID in PlantcircBase | ath_circ_000912 |
Alias | AT1G05960_C2, AT1G05960_C2 |
Organism | Arabidpsis thaliana |
Position | chr1: 1808736-1808936 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G05960 |
Parent gene annotation |
ARM repeat superfamily protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G05960.3:1 AT1G05960.4:1 AT1G05960.1:1 AT1G05960.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.517961885 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1808872-1808738(-) 1808769-1808869(-) |
Potential amino acid sequence |
MMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPVSSIPVP YDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPVSSI PVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPV SSIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKE MKRTNNIFSRRYQKLLGKLQVSLFPPFLYLMTK* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |