Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G05960_circ_g.1 |
| ID in PlantcircBase | ath_circ_000912 |
| Alias | AT1G05960_C2, AT1G05960_C2 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 1808736-1808936 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT1G05960 |
| Parent gene annotation |
ARM repeat superfamily protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G05960.3:1 AT1G05960.4:1 AT1G05960.1:1 AT1G05960.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.517961885 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1808872-1808738(-) 1808769-1808869(-) |
| Potential amino acid sequence |
MMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPVSSIPVP YDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPVSSI PVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKEVSETARQVASLPV SSIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKE MKRTNNIFSRRYQKLLGKLQVSLFPPFLYLMTK* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |