Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0817600_circ_g.1 |
ID in PlantcircBase | osa_circ_017194 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 35073977-35074271 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0817600 |
Parent gene annotation |
AUX/IAA protein family protein. (Os02t0817600-01);Similar to Aux in-responsive protein IAA10. (Os02t0817600-02);AUX/IAA protein f amily protein. (Os02t0817600-03) |
Parent gene strand | - |
Alternative splicing | Os02g0817600_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0817600-03:2 Os02t0817600-01:2 Os02t0817600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.254522458 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35074196-35073979(-) |
Potential amino acid sequence |
MLVGDVPWEMFVSSVKRLRIMRTSDANGLDNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVPWE MFVSSVKRLRIMRTSDANGLDNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVPWEMFVSSVKRL RIMRTSDANGLDNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVPWEMFVSSVKRLRIMRTSDAN GL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |