Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0116400_circ_g.3 |
| ID in PlantcircBase | osa_circ_035636 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 894550-894849 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os08g0116400 |
| Parent gene annotation |
Similar to CID11. (Os08t0116400-01);Nucleotide-binding, alpha-be ta plait domain containing protein. (Os08t0116400-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0116400_circ_g.2 |
| Support reads | 3/3 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0116400-02:2 Os08t0116400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.313989444 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
894607-894758(-) 894593-894831(-) |
| Potential amino acid sequence |
MMSVRCVQGLFTAQTLTRRECKGCSKFVGNRAWILSCQGAAIKNCDCTC*(-) MCARTIYCTNIDKKRVQGLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |