Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0116400_circ_g.3 |
ID in PlantcircBase | osa_circ_035636 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 894550-894849 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os08g0116400 |
Parent gene annotation |
Similar to CID11. (Os08t0116400-01);Nucleotide-binding, alpha-be ta plait domain containing protein. (Os08t0116400-02) |
Parent gene strand | - |
Alternative splicing | Os08g0116400_circ_g.2 |
Support reads | 3/3 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0116400-02:2 Os08t0116400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.313989444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
894607-894758(-) 894593-894831(-) |
Potential amino acid sequence |
MMSVRCVQGLFTAQTLTRRECKGCSKFVGNRAWILSCQGAAIKNCDCTC*(-) MCARTIYCTNIDKKRVQGLL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |