Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0207700_circ_g.1 |
| ID in PlantcircBase | osa_circ_030143 |
| Alias | Os_ciR10740 |
| Organism | Oryza sativa |
| Position | chr6: 5463082-5463582 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ie-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0207783 |
| Parent gene annotation |
Hypothetical protein. (Os06t0207783-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0207700_circ_g.2 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0207700-01:2 Os06t0207700-01:2 Os06t0207783-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006590* |
| PMCS | 0.37643691 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5463566-5463566(-) |
| Potential amino acid sequence |
MDNATWDAICDKLRQNLYITGSDILYQGGPVEKMVFIVRGRLESISADGNKSPLQEGDVCGEEL LSWYLEQSSVNRDGGKIKLHGMRLVAIRTVRCLTNVEAFVLRARDLEEVTSQFSRFLRNPLVLG TIRSGCLT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |