Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0207700_circ_g.1 |
ID in PlantcircBase | osa_circ_030143 |
Alias | Os_ciR10740 |
Organism | Oryza sativa |
Position | chr6: 5463082-5463582 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ie-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0207783 |
Parent gene annotation |
Hypothetical protein. (Os06t0207783-00) |
Parent gene strand | + |
Alternative splicing | Os06g0207700_circ_g.2 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0207700-01:2 Os06t0207700-01:2 Os06t0207783-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006590* |
PMCS | 0.37643691 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5463566-5463566(-) |
Potential amino acid sequence |
MDNATWDAICDKLRQNLYITGSDILYQGGPVEKMVFIVRGRLESISADGNKSPLQEGDVCGEEL LSWYLEQSSVNRDGGKIKLHGMRLVAIRTVRCLTNVEAFVLRARDLEEVTSQFSRFLRNPLVLG TIRSGCLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |