Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d038804_circ_g.1 |
ID in PlantcircBase | zma_circ_009158 |
Alias | Zm06circ00099 |
Organism | Zea mays |
Position | chr6: 164793150-164794150 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d038804 |
Parent gene annotation |
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase s ubunit STT3A |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d038804_T005:3 Zm00001d038804_T001:3 Zm00001d038804_T009:2 Zm00001d038804_T007:3 Zm00001d038804_T008:3 Zm00001d038804_T004:3 Zm00001d038804_T003:3 Zm00001d038804_T002:3 Zm00001d038804_T010:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.140970013 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
164793390-164793166(+) 164793215-164793322(+) 164793330-164794144(-) 164793201-164793400(-) |
Potential amino acid sequence |
MGYLPANKGSERYWSWINGSSHFSNGTPLAV*(+) MWWLLNSLNIPLSVETVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPPWPCDRW HCVSWVDIDCWNYVVVAELS*(+) MLREFSNHHIVPAVNVNPGYTVPPITRPRGYHC*(-) MSTQDTQCHRSHGQGGTIAKMAAAINPAPVPFASFVSR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |