Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d038804_circ_g.1 |
| ID in PlantcircBase | zma_circ_009158 |
| Alias | Zm06circ00099 |
| Organism | Zea mays |
| Position | chr6: 164793150-164794150 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d038804 |
| Parent gene annotation |
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase s ubunit STT3A |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d038804_T005:3 Zm00001d038804_T001:3 Zm00001d038804_T009:2 Zm00001d038804_T007:3 Zm00001d038804_T008:3 Zm00001d038804_T004:3 Zm00001d038804_T003:3 Zm00001d038804_T002:3 Zm00001d038804_T010:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.140970013 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
164793390-164793166(+) 164793215-164793322(+) 164793330-164794144(-) 164793201-164793400(-) |
| Potential amino acid sequence |
MGYLPANKGSERYWSWINGSSHFSNGTPLAV*(+) MWWLLNSLNIPLSVETVCVFTAPIFSANASWATYLLTKEAKGTGAGLMAAAILAMVPPWPCDRW HCVSWVDIDCWNYVVVAELS*(+) MLREFSNHHIVPAVNVNPGYTVPPITRPRGYHC*(-) MSTQDTQCHRSHGQGGTIAKMAAAINPAPVPFASFVSR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |