Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G64550_circ_g.9 |
ID in PlantcircBase | ath_circ_008650 |
Alias | At_ciR5499, Ath_circ_FC0869 |
Organism | Arabidpsis thaliana |
Position | chr1: 23972009-23972737 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, find_circ |
Parent gene | AT1G64550 |
Parent gene annotation |
ABC transporter F family member 3 |
Parent gene strand | + |
Alternative splicing | AT1G64550_circ_g.3 AT1G64550_circ_g.4 AT1G64550_circ_g.5 AT1G64550_circ_g.6 AT1G64550_circ_g.7 AT1G64550_circ_g.8 AT1G64550_circ_g.10 AT1G64550_circ_g.11 AT1G64550_circ_g.12 |
Support reads | 2/8 |
Tissues | leaf/root, inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G64550.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.217973788 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23972432-23972734(+) |
Potential amino acid sequence |
MMRCYPGVPEQKLRSHLGSLGVTGNLALQPMYTLSVVGPNGIGKSTILKLISGDLQPSSGTVFR SAKVRVAVFSQHHVDGLDLSSNPLLYMMRCYPGVPEQKLRSHLGSLGVTGNLALQPMYTLSVVG PNGIGKSTILKLISGDLQPSSGTVFRSAKVRVAVFSQHHVDGLDLSSNPLLYMMRCYPGVPEQK LRSHLGSLGVTGNLALQPMYTLSVVGPNGIGKSTILKLISGDLQPSSGTVFRSAKVRVAVFSQH HVDGLDLSSNPLLYMMRCYPGVPEQKLRSHLGSLGVTGNLALQPMYTLS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Chen et al., 2017a |