Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0554300_circ_g.4 |
| ID in PlantcircBase | osa_circ_015006 |
| Alias | Os_ciR4646 |
| Organism | Oryza sativa |
| Position | chr2: 20930741-20931599 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0554300 |
| Parent gene annotation |
Similar to SAC1-like protein AtSAC1b (SAC domain protein 6). (Os 02t0554300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0554300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.207507286 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20931596-20931226(+) 20931590-20931539(-) |
| Potential amino acid sequence |
MPCLQSGSDLNSSPRLCSLCKVSVKLISYEKYRPIVFSAACRSSENSVSILL*(+) MGGANDSSPSSKLHTRLRLWEFPDRYVFEPIDGLADLYLSANRSDGSMNLVEELPPRDSSTKPK CQTVYGVIGVLKLSVGSYFLVITGRDCVGSYLGHAIFKVTGLKVLPCSNSRSTSGNQSKMETEF SELLHAAEKTIGLYFSYDINLTLTLQRLHNLGDEFKSLPLWRQGIPPWVGQMTQVHPLNFTQD* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |