Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0649500_circ_g.6 |
ID in PlantcircBase | osa_circ_031786 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 26534027-26534982 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0649500 |
Parent gene annotation |
WD40 repeat-like domain containing protein. (Os06t0649500-01);TF IID subunit, WD40-associated region domain containing protein. ( Os06t0649500-02) |
Parent gene strand | + |
Alternative splicing | Os06g0649500_circ_g.1 Os06g0649500_circ_g.2 Os06g0649500_circ_g.3 Os06g0649500_circ_g.4 Os06g0649500_circ_g.5 Os06g0649500_circ_g.7 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0649500-01:4 Os06t0649500-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.180296914 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26534197-26534050(+) 26534931-26534050(+) 26534228-26534963(-) |
Potential amino acid sequence |
MSKIGQPPKTSSPQGENGLSQGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDS TIRLWSTKLNANLVCYKGHNYPVWDVQAKLLINFT*(+) MLILFATKDTTTLFGMYKLNCSSISHDGSLVVGGFSDSSVKVWDMSKIGQPPKTSSPQGENGLS QGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHN YPVWDVQAKLLINFT*(+) MFSAVGQSLTYPKPSLMSQRIHPQPKSRHVKLMSNLACTSQTG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |