Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0649500_circ_g.6 |
| ID in PlantcircBase | osa_circ_031786 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 26534027-26534982 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0649500 |
| Parent gene annotation |
WD40 repeat-like domain containing protein. (Os06t0649500-01);TF IID subunit, WD40-associated region domain containing protein. ( Os06t0649500-02) |
| Parent gene strand | + |
| Alternative splicing | Os06g0649500_circ_g.1 Os06g0649500_circ_g.2 Os06g0649500_circ_g.3 Os06g0649500_circ_g.4 Os06g0649500_circ_g.5 Os06g0649500_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0649500-01:4 Os06t0649500-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.180296914 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26534197-26534050(+) 26534931-26534050(+) 26534228-26534963(-) |
| Potential amino acid sequence |
MSKIGQPPKTSSPQGENGLSQGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDS TIRLWSTKLNANLVCYKGHNYPVWDVQAKLLINFT*(+) MLILFATKDTTTLFGMYKLNCSSISHDGSLVVGGFSDSSVKVWDMSKIGQPPKTSSPQGENGLS QGERTSASDYGKRPYTLFQGHSGPVYSAAFSPFGDFLLSSSSDSTIRLWSTKLNANLVCYKGHN YPVWDVQAKLLINFT*(+) MFSAVGQSLTYPKPSLMSQRIHPQPKSRHVKLMSNLACTSQTG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |