Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0892600_circ_g.1 |
ID in PlantcircBase | osa_circ_005179 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 38814578-38814704 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0892600 |
Parent gene annotation |
Pectinacetylesterase family protein. (Os01t0892600-02) |
Parent gene strand | - |
Alternative splicing | Os01g0892600_circ_igg.1 Os01g0892600_circ_igg.2 EPlOSAG00000014756_circ_ig.1 Os01g0892600_circ_igg.2 Os01g0892600_circ_igg.3 Os01g0892500_circ_ag.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0892600-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201279528 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
38814642-38814641(+) 38814632-38814641(+) 38814661-38814597(-) |
Potential amino acid sequence |
MNHTRSFCVWNNLRWCCTRLLPEFSCWSLLSIPLNSTARMNFDEPYALILRLEQSSMVLHQAPP RIQLLVIAEYPVELYCSHEFR*(+) MNFDEPYALILRLEQSSMVLHQAPPRIQLLVIAEYPVELYCSHEFR*(+) MSAYGSSKFMRAVEFNGILSNDQQLNSGRSLVQHHRRLFQTQNERVWFIEIHASSRVQRDTQQ* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |