Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0892600_circ_g.1 |
| ID in PlantcircBase | osa_circ_005179 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 38814578-38814704 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0892600 |
| Parent gene annotation |
Pectinacetylesterase family protein. (Os01t0892600-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0892600_circ_igg.1 Os01g0892600_circ_igg.2 EPlOSAG00000014756_circ_ig.1 Os01g0892600_circ_igg.2 Os01g0892600_circ_igg.3 Os01g0892500_circ_ag.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0892600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201279528 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
38814642-38814641(+) 38814632-38814641(+) 38814661-38814597(-) |
| Potential amino acid sequence |
MNHTRSFCVWNNLRWCCTRLLPEFSCWSLLSIPLNSTARMNFDEPYALILRLEQSSMVLHQAPP RIQLLVIAEYPVELYCSHEFR*(+) MNFDEPYALILRLEQSSMVLHQAPPRIQLLVIAEYPVELYCSHEFR*(+) MSAYGSSKFMRAVEFNGILSNDQQLNSGRSLVQHHRRLFQTQNERVWFIEIHASSRVQRDTQQ* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |