Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G26260_circ_g.1 |
ID in PlantcircBase | ath_circ_004402 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 9087836-9088154 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT1G26260 |
Parent gene annotation |
Transcription factor bHLH76 |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G26260.4:2 AT1G26260.1:2 AT1G26260.6:2 AT1G26260.3:2 AT1G26260.5:2 AT1G26260.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.181134848 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9087953-9088151(+) |
Potential amino acid sequence |
MRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCDKDCEEEEDKKQKDEQSPTSNANKTNS EKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFLQDLVPGCDKDCEEEEDKKQK DEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREKISERMKFLQDLVPG CDKDCEEEEDKKQKDEQSPTSNANKTNSEKQPSDSLKDGYIHMRARRGQATNSHSLAERVRREK ISERMKFLQDLVPGCDK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |