Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0689451_circ_g.4 |
ID in PlantcircBase | osa_circ_003413 |
Alias | Os_ciR5095 |
Organism | Oryza sativa |
Position | chr1: 28455839-28456194 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os01g0689451 |
Parent gene annotation |
Similar to predicted protein. (Os01t0689451-01);Similar to predi cted protein. (Os01t0689451-02) |
Parent gene strand | - |
Alternative splicing | Os01g0689451_circ_g.3 |
Support reads | 3/28 |
Tissues | root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0689451-01:1 Os01t0689451-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002309* |
PMCS | 0.459301511 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28456092-28455863(+) 28455923-28456154(-) 28455883-28456132(-) |
Potential amino acid sequence |
MEEASLQSQVASELDLVEFSVTFLVVFPSIHAKTTCGRCTHLQ*(+) MQQSGNFSDISSFNARLQFIADVCIFHRLSSRGSKGKQREK*(-) MQGCSLLQMCASSTGCLRVDRRENNEKSNREFHQV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |