Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0248600_circ_g.1 |
ID in PlantcircBase | osa_circ_001034 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 8180123-8181779 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0248600 |
Parent gene annotation |
GINS complex, Psf2 component family protein. (Os01t0248600-01) |
Parent gene strand | - |
Alternative splicing | Os01g0248600_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0248600-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.104605768 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8181708-8180181(+) 8181732-8181749(-) |
Potential amino acid sequence |
MRVRLPSHLDHRGTKLLPLFDDLVSLQHEYGQILSPDQSQPYGI*(+) MAGQSDPHLSIFSPSEVEFVAEDEIVEIVPNIRMEALNMICGDFGPFFPQIASKVPLWLAVALK KRGKCTIRTPDWMTVDRLTQVLDAERESPKEFQPLPFHYIEISKLLFDHARDDISDAYLVRSLI EDIRDVRFHKVETGLETISGRTHAVKTLNHQIEEAI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |