Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0185900_circ_g.2 |
ID in PlantcircBase | osa_circ_029952 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 4322771-4323317 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os06g0185900 |
Parent gene annotation |
Similar to Glutathione peroxidase. (Os06t0185900-01) |
Parent gene strand | + |
Alternative splicing | Os06g0185900_circ_g.3 Os06g0185900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0185900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.20444092 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4322999-4322822(+) 4322777-4323229(-) |
Potential amino acid sequence |
MRSTRLKDLRFLHFLAISLVHKNLGQTRRLSSLLVQGLKLNFLFLTRTLMEKMLRLASSREGRC *(+) MSLSKIGNSALNLVQANCLICGFDPGSCAPN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |