Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA009315_circ_g.1 |
| ID in PlantcircBase | osi_circ_004437 |
| Alias | 2:37494828|37496184 |
| Organism | Oryza sativa ssp. indica |
| Position | chr2: 37494828-37496184 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA009315 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA009315_circ_igg.1 BGIOSGA009315_circ_igg.2 BGIOSGA009315_circ_igg.3 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA009315-TA:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
37494838-37496079(-) 37494938-37494836(+) |
| Potential amino acid sequence |
MNDLNDLCNVPSGTSYDSTNMFISNTNSERILGIIVSR*(-) MRAIYLILSKLSEDVHYPPNLSSPFPYAGLGFPSYPGVPVGYMIPQVPYNNAVNYGPNGYGGRY QNKPSTPMRSPANNDAQDSLTIGIADEHIGAVVGRAGRNITEIIQVIH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |