Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0406800_circ_g.1 |
| ID in PlantcircBase | osa_circ_033464 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12578709-12579302 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os07g0406800 |
| Parent gene annotation |
DNA primase, large subunit, eukaryotic domain containing protein . (Os07t0406800-01);Similar to predicted protein. (Os07t0406800- 02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0406800-01:3 Os07t0406800-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.186762065 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12579004-12578739(+) 12578963-12578752(+) 12579254-12579299(-) |
| Potential amino acid sequence |
MGFPQFLDQFLHFLRSLPSREPVGDPLQYCDSGLSSRKR*(+) MSLFKVSVGSWCLIWAFHNSLTNFSISSGLFPRESPSAIPFNTVIQDSRAESDSEKA*(+) MEKLVKELWKAHMRHQDPTETLNKDIISHFVLRLVYCRTEELRKWFLSMETTLFRYRFRLESPE SQY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |