Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G35630_circ_g.43 |
| ID in PlantcircBase | ath_circ_016653 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 14975646-14975741 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, CIRI-full |
| Parent gene | AT2G35630 |
| Parent gene annotation |
Protein MOR1 |
| Parent gene strand | + |
| Alternative splicing | AT2G35630_circ_g.36 AT2G35630_circ_g.37 AT2G35630_circ_g.38 AT2G35630_circ_g.39 AT2G35630_circ_g.40 AT2G35630_circ_g.41 AT2G35630_circ_g.42 |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G35630.2:1 AT2G35630.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.196180553 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14975652-14975738(+) |
| Potential amino acid sequence |
MMKFFREDLQKRLLSPDFKKQVDGLEILQKNDMMKFFREDLQKRLLSPDFKKQVDGLEILQKND MMKFFREDLQKRLLSPDFKKQVDGLEILQKNDMMKFFREDLQKRLLSPDFKKQVDGLEILQK(+ ) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |