Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g092910.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000847 |
| Alias | 2:48435635|48437929 |
| Organism | Solanum lycopersicum |
| Position | chr2: 53857785-53860079 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc02g092910.2 |
| Parent gene annotation |
Protein MRG1 |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 12 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc02g092910.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.163827331 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
53859321-53859294(+) 53860045-53859294(+) |
| Potential amino acid sequence |
MKHTEDNVLKQQALDKKQGMEKSTKSGRSAPAKPKSSADVKLDKEETKSNGPKSRAAEERMEIL RSLPWLEQKLG*(+) MLNWTRKKLRAMVQKAELRKNEWRYFVHYLGWNKNWDEWVGADRLMKHTEDNVLKQQALDKKQG MEKSTKSGRSAPAKPKSSADVKLDKEETKSNGPKSRAAEERMEILRSLPWLEQKLG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |