Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0416900_circ_g.1 |
ID in PlantcircBase | osa_circ_037069 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 19938845-19939623 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0416900 |
Parent gene annotation |
Chaperone-like protein of protochlorophyllide oxidoreductase (PO R), J-like protein, Regulation of chlorophyll biosynthesis (Os08 t0416900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os08t0416900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007743* |
PMCS | 0.205357285 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19939019-19938902(+) 19938918-19939028(-) 19938974-19939616(-) |
Potential amino acid sequence |
MKSYSHRKKSKINLKSKIQKQVEESPSWFKAMLGFFEVPSAEIISRRLALFAFIAGWSIVTSAE TGPTFQLALSLVSCIYFLNEKMKNLSRASMTGACSVVPKTASMGPLQDSWC*(+) MHHDQHQESCRGPMLAVLGTTEHAPVIDALERFFIFSLRKYMHETSDSASWKVGPVSADVTMLH PAIKAKRASLLEIISADGTSKNPSIALNHDGDSSTCFCILLFRLILDFLRCE*(-) MPSILLKKKIPCTPDLFFGCIMINTKNLVGVPCLLSWEQRSMLLS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |