Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g006630.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000025 |
| Alias | Slcirc002 |
| Organism | Solanum lycopersicum |
| Position | chr1: 1224426-1224846 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g006630.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc01g006630.2_circ_g.1 Solyc01g006630.2_circ_g.2 Solyc01g006630.2_circ_g.4 |
| Support reads | 3/13 |
| Tissues | fruit/leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc01g006630.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.374934 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1224815-1224428(-) |
| Potential amino acid sequence |
MNSHVDKTLPPPDNISSMFQLENGCSGVFVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGY SLIGCEIASLSSMNSHVDKTLPPPDNISSMFQLENGCSGVFVMVVSSKSPKVIWRVVGLNGVLQ VDRGNKDGKHGYSLIGCEIASLSSMNSHVDKTLPPPDNISSMFQLENGCSGVFVMVVSSKSPKV IWRVVGLNGVLQVDRGNKDGKHGYSLIGCEIASLSSMNSHVDKTLPPPDNISSMFQLENGCSGV FVMVVSSKSPKVIWRVVGLNGVLQVDRGNKDGKHGYS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zuo et al., 2016; Wang et al., 2018b |