Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0542200_circ_g.1 |
| ID in PlantcircBase | osa_circ_028718 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 26914121-26915123 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0542200 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os05t054 2200-01);Similar to catalytic/ hydrolase. (Os05t0542200-02);Simi lar to cDNA clone:J023112L03, full insert sequence. (Os05t054220 0-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0542200_circ_g.2 Os05g0542200_circ_g.3 Os05g0542200_circ_g.4 Os05g0542200_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0542200-02:3 Os05t0542200-03:3 Os05t0542200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127035228 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26915103-26914797(+) 26915095-26915085(-) |
| Potential amino acid sequence |
MICPSHIPDEFSGWDDHSSGFIIDFVAFINSISALLTSSGLSWLTRCAP*(+) MQSNCGFEGQVNACWTHNMTTKELDTIRSAGFLVSVIHGRSDIIAQLCHARRLAERLIPVARMV ELHGAHLVSHERPEEVNNALMELIKATKSMMKPEEWSSQPENSSGICEGHIIDRDAV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |