Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G24400_circ_g.3 |
| ID in PlantcircBase | ath_circ_032549 |
| Alias | AT4G24400_C1, CircCIPK8 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 12618117-12618548 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI2 |
| Parent gene | AT4G24400 |
| Parent gene annotation |
CBL-interacting serine/threonine-protein kinase 8 |
| Parent gene strand | + |
| Alternative splicing | AT4G24400_circ_g.2 AT4G24400_circ_g.4 AT4G24400_circ_g.5 AT4G24400_circ_g.6 AT4G24400_circ_g.7 |
| Support reads | 1 |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GC-AG |
| Number of exons covered | AT4G24400.1:3 AT4G24400.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.381217814 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12618495-12618545(+) |
| Potential amino acid sequence |
MAGYLPFDEMDLPTLYSKPENLLLDSQGNLKISDFGLSALPEQGVTILKTTCGTPNYVAPEVLS HKGYNGAVADIWSCGVILYVLMAGYLPFDEMDLPTLYSKPENLLLDSQGNLKISDFGLSALPEQ GVTILKTTCGTPNYVAPEVLSHKGYNGAVADIWSCGVILYVLMAGYLPFDEMDLPTLYSKPENL LLDSQGNLKISDFGLSALPEQGVTILKTTCGTPNYVAPEVLSHKGYNGAVADIWSCGVILYVLM AGYLPFDEMDLPTLYSK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |