Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d047497_circ_g.1 |
ID in PlantcircBase | zma_circ_010042 |
Alias | zma_circ_0003078, GRMZM2G078238_C1 |
Organism | Zea mays |
Position | chr9: 132665109-132665926 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d047497 |
Parent gene annotation |
Protein LAZ1 homolog 1 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d047497_T004:3 Zm00001d047497_T001:3 Zm00001d047497_T010:3 Zm00001d047497_T002:3 Zm00001d047497_T008:3 Zm00001d047497_T006:3 Zm00001d047497_T003:3 Zm00001d047497_T005:3 Zm00001d047497_T009:3 Zm00001d047497_T011:3 Zm00001d047497_T012:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21689199 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
132665169-132665907(-) 132665902-132665860(-) |
Potential amino acid sequence |
MDIWHKGFKHVSRITLYALRWRRKYH*(-) MEGRLQISESSPLLDIDYDYGIVKHPFPLSCFMRNWYLGPDFYHAVKIGIVQYMILKPICAVLA IFFELLGIYGEGKFAWKYGYPYLAVVLNFSQTWALYCLIQFYTATKEKLQPIKPLSKFLTFKSI VFLTWWQGVAVAFLFSTGLFNGHLAQRFQTRIQDYIICLEVEKKVPLGLWRVGFKSVRAHLC*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |