Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d047497_circ_g.1 |
| ID in PlantcircBase | zma_circ_010042 |
| Alias | zma_circ_0003078, GRMZM2G078238_C1 |
| Organism | Zea mays |
| Position | chr9: 132665109-132665926 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d047497 |
| Parent gene annotation |
Protein LAZ1 homolog 1 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d047497_T004:3 Zm00001d047497_T001:3 Zm00001d047497_T010:3 Zm00001d047497_T002:3 Zm00001d047497_T008:3 Zm00001d047497_T006:3 Zm00001d047497_T003:3 Zm00001d047497_T005:3 Zm00001d047497_T009:3 Zm00001d047497_T011:3 Zm00001d047497_T012:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21689199 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
132665169-132665907(-) 132665902-132665860(-) |
| Potential amino acid sequence |
MDIWHKGFKHVSRITLYALRWRRKYH*(-) MEGRLQISESSPLLDIDYDYGIVKHPFPLSCFMRNWYLGPDFYHAVKIGIVQYMILKPICAVLA IFFELLGIYGEGKFAWKYGYPYLAVVLNFSQTWALYCLIQFYTATKEKLQPIKPLSKFLTFKSI VFLTWWQGVAVAFLFSTGLFNGHLAQRFQTRIQDYIICLEVEKKVPLGLWRVGFKSVRAHLC*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |