Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d042267_circ_g.3 |
ID in PlantcircBase | zma_circ_007688 |
Alias | Zm03circ00057 |
Organism | Zea mays |
Position | chr3: 158101352-158101679 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d042267 |
Parent gene annotation |
Auxin response factor 10 |
Parent gene strand | - |
Alternative splicing | Zm00001d042267_circ_g.1 Zm00001d042267_circ_g.2 Zm00001d042267_circ_g.4 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d042267_T002:2 Zm00001d042267_T005:2 Zm00001d042267_T010:2 Zm00001d042267_T004:2 Zm00001d042267_T008:2 Zm00001d042267_T003:2 Zm00001d042267_T009:2 Zm00001d042267_T001:2 Zm00001d042267_T007:1 Zm00001d042267_T011:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.225376936 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
158101641-158101622(-) |
Potential amino acid sequence |
MESVKNNYSIGMRFRMRFEGEEAPEQRFTGTIVGCENLDPLWPDSSWRYLKDEPFRVHHTVRSI YGVGKK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020 |