Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0513200_circ_g.2 |
| ID in PlantcircBase | osa_circ_028499 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 25448470-25449664 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0513200 |
| Parent gene annotation |
NLI interacting factor domain containing protein. (Os05t0513200- 00) |
| Parent gene strand | + |
| Alternative splicing | Os05g0513200_circ_g.1 Os05g0513200_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0513200-00:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.116945084 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25449631-25448503(+) 25448497-25448484(+) 25448527-25449654(-) |
| Potential amino acid sequence |
MKLLCILIRCLCSCCSNRILHGC*(+) MDVRHTIEDHIRGFAEPTSDKLLPDLDPLNQHIFTLVLDLNETLVYSDWLRERGWRTFKRPGVD AFIEHMGKFYEVVVYSDQMPMLLLQQ*(+) MVLNCVSNIHVEFYCCNRSIGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |