Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0126050_circ_g.1 |
| ID in PlantcircBase | osa_circ_029466 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 1391059-1393240 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0126050 |
| Parent gene annotation |
Hypothetical protein. (Os06t0126050-00) |
| Parent gene strand | + |
| Alternative splicing | Os06g0126050_circ_g.2 |
| Support reads | 4 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0126000-02:6 Os06t0126000-05:5 Os06t0126000-04:6 Os06t0126000-01:6 Os06t0126000-02:6 Os06t0126000-05:5 Os06t0126050-00:5 Os06t0126000-04:6 Os06t0126000-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.117510075 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1393222-1391122(+) 1392463-1393226(-) |
| Potential amino acid sequence |
MSQRHESYRTKLVLVAEFNQVFHVIHHL*(+) MANEFRLPNGLMLLEHTKVVQKSIYEHMHVIHEGQLRIIFTPELKIMSWEFCSRRHDEYITRRF LSPQVAHLLQVAQKYQTVATESGPAGVSNSDAQNICNMFVTASRQLAKNIDHHTLNEHGLSKRY VRCLQISEVVNHMKDLIEFSHKNKLGPIGFMAL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |