Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0605500_circ_g.1 |
| ID in PlantcircBase | osa_circ_025105 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 30574312-30574641 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os04g0605500 |
| Parent gene annotation |
P-type IIB Ca(2+) ATPase, Stress tolerance (Os04t0605500-01);Sim ilar to Calcium-transporting ATPase 8, plasma membrane-type (EC 3.6.3.8) (Ca(2+)-ATPase isoform 8). (Os04t0605500-02);Similar to P-type ATPase (Fragment). (Os04t0605500-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0605500_circ_g.2 Os04g0605500_circ_g.3 Os04g0605500_circ_g.4 Os04g0605500_circ_g.5 Os04g0605500_circ_g.6 Os04g0605500_circ_g.7 Os04g0605500_circ_g.8 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0605500-03:2 Os04t0605500-02:2 Os04t0605500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.203636465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30574393-30574583(-) |
| Potential amino acid sequence |
MDTLGALALATEPPTDHLMQRPPVGRRLSDGVARFMQTFRNLYSFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |