Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.002G063000_circ_g.1 |
| ID in PlantcircBase | gra_circ_000127 |
| Alias | Chr02:7402389|7403262 |
| Organism | Gossypium raimondii |
| Position | chrChr02: 7402389-7403262 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.002G063000 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-No |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.002G063000.2:2 Gorai.002G063000.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.437741791 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7403220-7403202(-) |
| Potential amino acid sequence |
MDLSPSEVSSPFKNNEADQSKYLKTELITSVEPQLAESGASKCLAYNKRIGFKRGSIVSEIDKR KATMPKDQQYRMRKKMELQKLKDEIRWYQEELSQLRAKQQLPAQDLDKNYLQFNQADTVSRKHG PFSV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |