Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_16G101500_circ_g.4 |
| ID in PlantcircBase | gma_circ_007323 |
| Alias | gma-circRNA2209 |
| Organism | Glycine max |
| Position | chr16: 20382556-20383660 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_16G101500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_16G101500_circ_g.3 GLYMA_16G101500_circ_g.5 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH07651:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.54778204 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20383306-20383656(-) 20382618-20383634(-) |
| Potential amino acid sequence |
MVQHPPANSYGSVGSHGSYNDSVGLGSSYGSYGESSNMFAYYSPIGPSGMNMHNQGSMSMLGNS PDARRRVKYQPGNGLGISPSAGNFAPLPLGASPSQFTPPSSYSQVSVSSPGHYGPTSPARGTSH GSPLGKTAAVSQFNRRKNWGHSGSPQTQETFSSHWPGQYPDSTSHTEGTSQALGSSPSYLQSNS NPGNWKQRGSGGLSANQNISSLMKPSASMNPQSTEVVHDNAETGISLPDPGDWDPNYSQ*(-) MTMRRQAFLCLILVIGTLIIASSSKYQGG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |