Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G19670_circ_g.9 |
| ID in PlantcircBase | ath_circ_022737 |
| Alias | Ath_circ_FC2078 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 6830838-6831286 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT3G19670 |
| Parent gene annotation |
Pre-mRNA-processing protein 40B |
| Parent gene strand | - |
| Alternative splicing | AT3G19670_circ_g.1 AT3G19670_circ_g.2 AT3G19670_circ_g.3 AT3G19670_circ_g.4 AT3G19670_circ_g.5 AT3G19670_circ_g.6 AT3G19670_circ_g.7 AT3G19670_circ_g.8 AT3G19670_circ_g.10 AT3G19670_circ_g.11 AT3G19670_circ_g.12 |
| Support reads | 1 |
| Tissues | aerial |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G19670.3:3 AT3G19670.2:3 AT3G19670.1:3 AT3G19670.4:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204310356 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6831037-6830840(-) |
| Potential amino acid sequence |
MKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKREYLRDLEREEEEKKKIQKEELKKVERKHR DEFHGLLDEHIATGELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKREYL RDLEREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIATGELTAKTIWRDYLMKVKDLPVYSAI ASNSSGATPKDLFEDAVEDLKKREYLRDLEREEEEKKKIQKEELKKVERKHRDEFHGLLDEHIA TGELTAKTIWRDYLMKVKDLPVYSAIASNSSGATPKDLFEDAVEDLKKR(-) |
| Sponge-miRNAs | ath-miR869.1 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Chen et al., 2017a |