Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G072300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000584 |
| Alias | Chr06:29032491|29033118 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 29032491-29033118 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G072300 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 10 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.006G072300.4:2 Gorai.006G072300.1:2 Gorai.006G072300.3:2 Gorai.006G072300.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000351* |
| PMCS | 0.65067293 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29032997-29032506(+) 29033109-29032636(+) |
| Potential amino acid sequence |
MTSFFFSSILKITYRNTFFLCSSRYVLLLCSATPMPDDAFPSRKFS*(+) MHFPLGSFPKHVNSGSGRLMCTLPNHLEIHFSRVGCLDFVMDALQFPSEPVL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |