Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0151200_circ_g.4 |
| ID in PlantcircBase | osa_circ_000354 |
| Alias | Os01circ02545 |
| Organism | Oryza sativa |
| Position | chr1: 2772004-2772108 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os01g0151200 |
| Parent gene annotation |
Similar to Inner membrane protein ALBINO3, chloroplast precursor . Splice isoform 2. (Os01t0151200-01);Similar to inner membrane protein ALBINO3. (Os01t0151200-02);Similar to inner membrane pro tein ALBINO3. (Os01t0151200-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0151200-02:1 Os01t0151200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.303973333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2772088-2772006(-) 2772039-2772052(-) |
| Potential amino acid sequence |
MPAPLCRAAIVVGPPKDGIQKNPSVSNPTKGKSQEMPAPLCRAAIVVGPPKDGIQKNPSVSNPT KGKSQEMPAPLCRAAIVVGPPKDGIQKNPSVSNPTKGKSQEMPAPLCRAAIVVGPPKDGIQKNP SVSN(-) MESRKILLSVIPQKARAKKCQHHFAEQQLL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |