Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0367000_circ_g.4 |
| ID in PlantcircBase | osa_circ_019963 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 14366640-14369154 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0367000 |
| Parent gene annotation |
Similar to Pasticcino 1-A. (Os03t0367000-01);Hypothetical conser ved gene. (Os03t0367000-02) |
| Parent gene strand | + |
| Alternative splicing | Os03g0367000_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0367000-01:6 Os03t0367000-02:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21862825 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14368772-14366640(+) 14366652-14366678(+) 14366670-14369117(-) |
| Potential amino acid sequence |
MKRCLESTTMCILKMMMRGKSLLIQE*(+) MDCPLHDSLLRVHYKGMLLDEPKSIFYDTRVDNHGEPLEFCSGEGLVPEGFEMCVRLMLPGEKS IVTCPPDFAYDKFPRPANVPEGAHVQWEIELLGFEMPKDWTGFTFQEIMDDAEKIKTTGNRLFK EGKFELAKAKYEKVLREYNHVHPQDDDEGKIFANSRVNFLWTVLFMIAC*(+) MKRTVHRKFTLELAKIFPSSSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |