Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d030782_circ_g.1 |
| ID in PlantcircBase | zma_circ_006654 |
| Alias | zma_circ_0000289 |
| Organism | Zea mays |
| Position | chr1: 159424787-159426668 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d030782 |
| Parent gene annotation |
Formin-like protein 20 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d030781_circ_igg.1 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d030782_T001:4 Zm00001d030782_T003:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.043403471 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
159426625-159424931(+) 159426114-159426662(-) |
| Potential amino acid sequence |
MVNRDSNSFTSNSARMLTLSKSFLVPTVVL*(+) MLTKIKMPLPDMMSAALALDDSVLDADQIENLIKFCPTKEEMELLKNYSGDKEALGKCEHSC*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |