Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d030782_circ_g.1 |
ID in PlantcircBase | zma_circ_006654 |
Alias | zma_circ_0000289 |
Organism | Zea mays |
Position | chr1: 159424787-159426668 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d030782 |
Parent gene annotation |
Formin-like protein 20 |
Parent gene strand | - |
Alternative splicing | Zm00001d030781_circ_igg.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d030782_T001:4 Zm00001d030782_T003:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.043403471 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
159426625-159424931(+) 159426114-159426662(-) |
Potential amino acid sequence |
MVNRDSNSFTSNSARMLTLSKSFLVPTVVL*(+) MLTKIKMPLPDMMSAALALDDSVLDADQIENLIKFCPTKEEMELLKNYSGDKEALGKCEHSC*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |