Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0156800_circ_g.16 |
| ID in PlantcircBase | osa_circ_026689 |
| Alias | Os05circ03664/Os_ciR10192 |
| Organism | Oryza sativa |
| Position | chr5: 3333052-3333161 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | SMALT, Segemehl, find_circ |
| Parent gene | Os05g0156800 |
| Parent gene annotation |
Conserved hypothetical protein. (Os05t0156800-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0156800_circ_g.13 Os05g0156800_circ_g.14 Os05g0156800_circ_g.15 Os05g0156800_circ_g.17 |
| Support reads | 3/2 |
| Tissues | leaf/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0156800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.323316498 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3333056-3333052(+) |
| Potential amino acid sequence |
MESGETTQSISLVDMRKKPEERGLDKEEEDYFNKGS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015 |