Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0156800_circ_g.16 |
ID in PlantcircBase | osa_circ_026689 |
Alias | Os05circ03664/Os_ciR10192 |
Organism | Oryza sativa |
Position | chr5: 3333052-3333161 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | SMALT, Segemehl, find_circ |
Parent gene | Os05g0156800 |
Parent gene annotation |
Conserved hypothetical protein. (Os05t0156800-01) |
Parent gene strand | + |
Alternative splicing | Os05g0156800_circ_g.13 Os05g0156800_circ_g.14 Os05g0156800_circ_g.15 Os05g0156800_circ_g.17 |
Support reads | 3/2 |
Tissues | leaf/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0156800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.323316498 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3333056-3333052(+) |
Potential amino acid sequence |
MESGETTQSISLVDMRKKPEERGLDKEEEDYFNKGS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015 |