Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0178100_circ_g.4 |
ID in PlantcircBase | osa_circ_013465 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 4316063-4316191 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0178100 |
Parent gene annotation |
Similar to CONSTANS-like protein CO6. (Os02t0178100-01) |
Parent gene strand | + |
Alternative splicing | Os02g0178100_circ_g.5 Os02g0178100_circ_g.6 Os02g0178100_circ_g.7 Os02g0178100_circ_g.8 Os02g0178100_circ_g.9 Os02g0178100_circ_g.10 |
Support reads | 2 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0178100-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002017 |
PMCS | 0.356235142 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4316190-4316065(-) 4316129-4316160(-) |
Potential amino acid sequence |
MARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRAAMARGRGVWQVGRLGLREVELD DSAAAAAADGVRHQPDLRRRAAMARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRA AMARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRA(-) MIPPPPPPQMASGTSPTSDDEPLWLGVEAYGR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |