Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0178100_circ_g.4 |
| ID in PlantcircBase | osa_circ_013465 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 4316063-4316191 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0178100 |
| Parent gene annotation |
Similar to CONSTANS-like protein CO6. (Os02t0178100-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0178100_circ_g.5 Os02g0178100_circ_g.6 Os02g0178100_circ_g.7 Os02g0178100_circ_g.8 Os02g0178100_circ_g.9 Os02g0178100_circ_g.10 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0178100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002017 |
| PMCS | 0.356235142 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4316190-4316065(-) 4316129-4316160(-) |
| Potential amino acid sequence |
MARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRAAMARGRGVWQVGRLGLREVELD DSAAAAAADGVRHQPDLRRRAAMARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRA AMARGRGVWQVGRLGLREVELDDSAAAAAADGVRHQPDLRRRA(-) MIPPPPPPQMASGTSPTSDDEPLWLGVEAYGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |