Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0496800_circ_g.3 |
| ID in PlantcircBase | osa_circ_030951 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 17379869-17380383 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0496800 |
| Parent gene annotation |
Similar to S-locus receptor kinase precursor. (Os06t0496800-01); Similar to S-locus receptor kinase precursor. (Os06t0496800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0496800-02:2 Os06t0496800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006765* osi_circ_016241 |
| PMCS | 0.562490531 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17380019-17379964(+) 17380048-17380375(-) |
| Potential amino acid sequence |
MSPKISDFGMAKIFEDECNEVNTGRVVGTYGYMAPEFALEGVYSVKSDVFSFGVLLLEILSGQR NGALYLEEHQQSLIQDTRGRARSWGGRRGTTSSWGSRGDCCTCTRTRC*(+) MPKSEILGLILSSRRTLLALRSRCTTFSNESSCRYNNPLAIPTMMLCLVAHPSCALFPSCLG*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |