Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0293850_circ_g.1 |
ID in PlantcircBase | osa_circ_019328 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 10239614-10240071 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os03g0293850 |
Parent gene annotation |
Similar to Ribosomal protein S15 containing protein. (Os03t02938 50-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4/4 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0293850-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.124668614 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10239664-10240018(-) |
Potential amino acid sequence |
MERSGSCLKSCRDRSPDPEPVGKLDVTDQGRRIC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |