Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0293850_circ_g.1 |
| ID in PlantcircBase | osa_circ_019328 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 10239614-10240071 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os03g0293850 |
| Parent gene annotation |
Similar to Ribosomal protein S15 containing protein. (Os03t02938 50-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 4/4 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0293850-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.124668614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10239664-10240018(-) |
| Potential amino acid sequence |
MERSGSCLKSCRDRSPDPEPVGKLDVTDQGRRIC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |