Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0554050_circ_g.3 |
| ID in PlantcircBase | osa_circ_037983 |
| Alias | Os_ciR5624 |
| Organism | Oryza sativa |
| Position | chr8: 27709140-27710491 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os08g0554050 |
| Parent gene annotation |
Similar to auxin-independent growth promoter. (Os08t0554050-01) |
| Parent gene strand | + |
| Alternative splicing | Os08g0554050_circ_g.1 Os08g0554050_circ_g.2 Os08g0554050_circ_g.4 |
| Support reads | 3/2 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0554050-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018143 |
| PMCS | 0.384926596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27709425-27709421(+) |
| Potential amino acid sequence |
MIVTSGGLNQQRTGIIDAVVAARILNATLVVPKLDQTSFWKDASNFSEIFDVDWFISNLSKDVK IVKELPEIGGKLRTPHRMRVPRKCTQRCYVNRVLPALLKKHVVRLTKFDYRLANRLDTDLQKLR CRVNYHGLRFTGLIEEMGEKLIQRMRERSKHFIALHLRKRQMAFGVLSLRADSMGAATQAAGSL VQVLSRNQTVI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |