Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.001G243800_circ_g.1 |
| ID in PlantcircBase | gra_circ_000099 |
| Alias | Chr01:48585092|48585396 |
| Organism | Gossypium raimondii |
| Position | chrChr01: 48585092-48585396 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.001G243800 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.001G243800.1:2 Gorai.001G243800.2:1 Gorai.001G243800.3:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.296265601 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
48585138-48585210(+) 48585394-48585184(+) |
| Potential amino acid sequence |
MRYISELEHKVQTLQTEATTLSAQLTLLQRDSVGLTNQNNELKFRLQAMEQQAQLRDGFWPIVS LLLVPKNGRCGTFQSWNTRFRLCRLKLPHCLLS*(+) MDFGQSSVCCSFQRTEDAVHFRVGTQGSDSAD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |