Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G36740_circ_g.3 |
ID in PlantcircBase | ath_circ_016899 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 15408760-15409224 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G36740 |
Parent gene annotation |
SWR1 complex subunit 2 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G36740.2:3 AT2G36740.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.147688369 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15408969-15409221(+) |
Potential amino acid sequence |
MFFLFKSFLIPKLFIFFYFVIKQLGHPQFFFIYSDCIRLRLIVIEVTVKLISNLTFCFIFIIMF FLFKSFLIPKLFIFFYFVIKQLGHPQFFFIYSDCIRLRLIVIEVTVKLISNLTFCFIFIIMFFL FKSFLIPKLFIFFYFVIKQLGHPQFFFIYSDCIRLRLIVIEVTVKLISNLTFCFIFIIMFFLFK SFLIPKLFIFFYFVIKQLGH(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |