Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0611400_circ_g.1 |
ID in PlantcircBase | osa_circ_025192 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 31005722-31006020 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0611400 |
Parent gene annotation |
Similar to Vacuolar sorting receptor 7 precursor (AtVSR7) (Epide rmal growth factor receptor-like protein 3) (AtELP3) (BP80-like protein f) (AtBP80f). (Os04t0611400-01) |
Parent gene strand | + |
Alternative splicing | Os04g0611400_circ_g.2 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0611400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.103121851 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31005962-31006017(+) |
Potential amino acid sequence |
MNNGGCWKGTRDGKTFSACSDTFRGRICQCPVVDGVQYQGDGYTHCKAVGPGRCAMNNGGCWKG TRDGKTFSACSDTFRGRICQCPVVDGVQYQGDGYTHCKAVGPGRCAMNNGGCWKGTRDGKTFSA CSDTFRGRICQCPVVDGVQYQGDGYTHCKAVGPGRCAMNNGGCWKGTRDGKTFSACS(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |