Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Solyc12g010740.1_circ_g.2 |
ID in PlantcircBase | sly_circ_003537 |
Alias | 12:3665868|3667363 |
Organism | Solanum lycopersicum |
Position | chr12: 3665868-3667363 JBrowse» |
Reference genome | SL2.50.38 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Solyc12g010740.1 |
Parent gene annotation |
protein_coding |
Parent gene strand | + |
Alternative splicing | Solyc12g010740.1_circ_g.1 |
Support reads | 5 |
Tissues | fruit |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Solyc12g010740.1.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.210167708 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3665961-3665934(+) 3665963-3667361(-) |
Potential amino acid sequence |
MTAVPKKDDSVINLGRLDIDLTPPPPPPPPPPTLPQERVIVEPIAPAKDTATRLPTRPLPLTSV KSYTIASLQQYTNSFSQDNLLGSGMLGSVYRVELPNGKLLAVKKLDKRVCDQQTDDEFLDLVNN IDRIRHANVVELMGYCAEHGQRLLVYEYCCNGTLQDALHCDDEFKRQLSWNTRMRMALGAARAL DSPSCAAKRKATKKTGSRSEATR*(+) MVCTFTCCSSCGFGTGAGLLGCFSFGGTTRGV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | fruit ripening |
Other Information | |
---|---|
References | Yin et al., 2018 |