Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G030400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001081 |
| Alias | Chr10:2586861|2587385 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 2586861-2587385 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | u-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G030400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | No-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.010G030400.7:2 Gorai.010G030400.6:2 Gorai.010G030400.5:2 Gorai.010G030400.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.479802825 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2587035-2586988(+) 2586871-2587308(-) |
| Potential amino acid sequence |
MLRRLGWLIGLNNRSVQAKKLPDAKPHPAEVQPVVMLDSVQEIAIYIHRFHNLDLFQQGWYQLK LTVRWDNDEYAPVGTPARVVQYEAVCICLVPRELKTRINKVFVWLLCSFDDFYETRIDSVLRMM QE*(+) MQTASYWTTLAGVPTGAYSSLSHLTVSFS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |