Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0578900_circ_g.1 |
ID in PlantcircBase | osa_circ_008192 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 23080346-23081041 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0578900 |
Parent gene annotation |
Similar to CTP:phosphorylcholine cytidylyltransferase (EC 2.7.7. 15). (Os10t0578900-01);Similar to CTP:phosphorylcholine cytidyly ltransferase (EC 2.7.7.15). (Os10t0578900-02) |
Parent gene strand | - |
Alternative splicing | Os10g0578900_circ_g.2 Os10g0578900_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0578900-01:4 Os10t0578900-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187348479 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23080958-23080395(+) 23080989-23080569(+) 23080643-23081035(-) |
Potential amino acid sequence |
MSNIVNLMFVNELLREDPWSIRNDLINPSFLDAPLQSLAVYLSSC*(+) MNSCVRTHGASGMTSSTHLFLMRLYSLSQFIYLHVDLELLFLNIAYA*(+) MRILKDYNQYVMRNLARGYTRKDLGVSYVKEKQLQVNMKINKLRETVKAHQEKMG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |