Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0578900_circ_g.1 |
| ID in PlantcircBase | osa_circ_008192 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 23080346-23081041 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0578900 |
| Parent gene annotation |
Similar to CTP:phosphorylcholine cytidylyltransferase (EC 2.7.7. 15). (Os10t0578900-01);Similar to CTP:phosphorylcholine cytidyly ltransferase (EC 2.7.7.15). (Os10t0578900-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0578900_circ_g.2 Os10g0578900_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0578900-01:4 Os10t0578900-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187348479 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23080958-23080395(+) 23080989-23080569(+) 23080643-23081035(-) |
| Potential amino acid sequence |
MSNIVNLMFVNELLREDPWSIRNDLINPSFLDAPLQSLAVYLSSC*(+) MNSCVRTHGASGMTSSTHLFLMRLYSLSQFIYLHVDLELLFLNIAYA*(+) MRILKDYNQYVMRNLARGYTRKDLGVSYVKEKQLQVNMKINKLRETVKAHQEKMG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |