Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0366000_circ_g.3 |
| ID in PlantcircBase | osa_circ_036855 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 16967483-16967586 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os08g0366050 |
| Parent gene annotation |
Hypothetical protein. (Os08t0366050-00) |
| Parent gene strand | + |
| Alternative splicing | Os08g0366000_circ_g.2 Os08g0366000_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0366000-03:1 Os08t0366000-01:1 Os08t0366000-02:1 Os08t0366000-03:1 Os08t0366050-00:1 Os08t0366000-01:1 Os08t0366000-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.756692708 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
16967491-16967490(+) 16967535-16967574(-) |
| Potential amino acid sequence |
MRSSICEQYKFEAIILASKHTSLVTSGVTLGFPQT*(+) MMASNLYCSQIEDLMFEEIQE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |