Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0587550_circ_g.1 |
ID in PlantcircBase | osa_circ_009688 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 22270104-22270207 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ei-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0587550 |
Parent gene annotation |
Hypothetical protein. (Os11t0587550-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0587500-01:1 Os11t0587550-00:1 Os11t0587500-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.286859936 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22270200-22270116(+) 22270136-22270154(-) |
Potential amino acid sequence |
MDTLLFSLICSRSSKVLPGSKQPSKNSQTSPLIVGWTPFFSP*(+) MSASRLGRKEGCPSYNQGRGLGVFTWLF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |