Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0587550_circ_g.1 |
| ID in PlantcircBase | osa_circ_009688 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 22270104-22270207 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ei-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0587550 |
| Parent gene annotation |
Hypothetical protein. (Os11t0587550-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0587500-01:1 Os11t0587550-00:1 Os11t0587500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.286859936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22270200-22270116(+) 22270136-22270154(-) |
| Potential amino acid sequence |
MDTLLFSLICSRSSKVLPGSKQPSKNSQTSPLIVGWTPFFSP*(+) MSASRLGRKEGCPSYNQGRGLGVFTWLF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |